PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00002996-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NF-YB
Protein Properties Length: 238aa    MW: 26585.5 Da    PI: 5.1077
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00002996-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB172.25.8e-5445141197
               NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                         vreqd+flPianv+rim+++lP +akis+daket+qecvsefisf+t+ea+++cqre+rkt++++dllwa+a+lGf+dyvepl+vyl++yr
  WALNUT_00002996-RA  45 VREQDQFLPIANVIRIMRRILPPHAKISDDAKETIQECVSEFISFITGEANERCQREQRKTVTAEDLLWAMAKLGFDDYVEPLNVYLNRYR 135
                         69***************************************************************************************** PP

               NF-YB  92 elegek 97 
                         e+e+e+
  WALNUT_00002996-RA 136 EAENER 141
                         ***987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.7E-5043148IPR009072Histone-fold
SuperFamilySSF471136.99E-3848148IPR009072Histone-fold
PfamPF008088.3E-2751115IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.1E-167997No hitNo description
PROSITE patternPS0068508298IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.1E-1698116No hitNo description
PRINTSPR006152.1E-16117135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045723Biological Processpositive regulation of fatty acid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MFISASAILL PNNSTNNTPN TNNEDTNTFN SPDHHQQDDS PCMQVREQDQ FLPIANVIRI  60
MRRILPPHAK ISDDAKETIQ ECVSEFISFI TGEANERCQR EQRKTVTAED LLWAMAKLGF  120
DDYVEPLNVY LNRYREAENE RGGSSSSSTL RGRDPKLPLY PKRSGLDIHG PIMAVPPPFG  180
PSFPMGHLPG MFDAAAAMTG YYRDHVPAPA EGSSPDDDHH HHNALASYDP FVPRSNDP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B2e-4043136194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4043136194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465928.11e-71PREDICTED: nuclear transcription factor Y subunit B-9
SwissprotQ9SFD85e-67NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLA0A0D2SEP91e-71A0A0D2SEP9_G
TrEMBLA0A0E3N6S21e-71A0A0E3N6S2_G
STRINGVIT_00s0956g00020.t019e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.13e-66NF-YB family protein